DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and sphinx2

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:254 Identity:64/254 - (25%)
Similarity:102/254 - (40%) Gaps:43/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGKTATSGQFPYQVGLSFAST--SGSWWCGGSIIDNTWVLTA----------AHCTS----- 86
            |||.|..|......|.||:.:|.:  |...:..|:||.|.|:||.          ||..|     
  Fly    25 RITGGYRAKPYTIIYLVGIVYAKSPLSSLKFGAGTIISNQWILTVKEVLIFKYIEAHFGSKRAFW 89

  Fly    87 GASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIKTPTVAFTALINKVELPAI 151
            |...:.||                .:||..|.....|     |:|:|.|...|...:::|.:||.
  Fly    90 GYDILRIY----------------RENFYFHYDKTRI-----IALVKCPYQKFDRRMSRVRVPAY 133

  Fly   152 AGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNK 216
            ...:..|.|...:..||| |......:...::....||::.::|...:..|....  :|.:....
  Fly   134 GARFERYVGNMTMVCGWG-TDKRKVRLPTWMRCVEVEVMNNTECAKYHTPLKWYE--MCTSGEGF 195

  Fly   217 VSTCNGDSGGPLVLVS-DSKLIGVTSFVSSAGCESGAPAGFTRVTSYLDWIKTNTGVSY 274
            ...|.||.||.:|.:. :...||:. ::....|..|.|:...||:.::.|||..:||.:
  Fly   196 KGVCEGDMGGAVVTMGPNPTFIGII-WLMPTNCSIGYPSVHIRVSDHIKWIKHVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 59/244 (24%)
Tryp_SPc 40..269 CDD:238113 61/246 (25%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 59/244 (24%)
Tryp_SPc 26..248 CDD:304450 61/246 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471013
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.