DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Jon65Ai

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001286951.1 Gene:Jon65Ai / 38685 FlyBaseID:FBgn0035667 Length:262 Species:Drosophila melanogaster


Alignment Length:276 Identity:134/276 - (48%)
Similarity:170/276 - (61%) Gaps:16/276 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLVVFAL-ALATASAGLLPQQVPIHPRDLP-AVTNIEGRITNGKTATSGQFPYQVGLSFASTS 63
            ||||.|..| .:|:|:|    .:.|:..:|:| ...:||||||.|..|..|:.||.|||.|:...
  Fly     1 MKVLAVLLLGVIASATA----FEKPVFWKDVPVGKASIEGRITMGYPAYEGKVPYIVGLGFSKNG 61

  Fly    64 GSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRND 128
            |..|||||||.||||:||.|||.|..:|||||||..|..||....|...:|::|.|       .|
  Fly    62 GGTWCGGSIIGNTWVMTAKHCTDGMESVTIYYGALWRLQAQYTHWVGRSDFIEHGS-------GD 119

  Fly   129 ISLIKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVS 193
            ||||:||.|.|.:|:||||||.....|:.|.|..|:.||||||||.. .|:..|.....::...|
  Fly   120 ISLIRTPHVDFWSLVNKVELPRYDDRYNNYQGWWALVSGWGKTSDEG-GVSEYLNCVDVQIGENS 183

  Fly   194 QCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAGCESGAPAGFTR 258
            .|:|.|||.  :.::||:.||....||:||||||||:...::.:|:.||.|||||.|..|.|..|
  Fly   184 VCENYYGSF--SGDLICIPTPENKGTCSGDSGGPLVIHDGNRQVGIVSFGSSAGCLSNGPKGMVR 246

  Fly   259 VTSYLDWIKTNTGVSY 274
            ||||||||:.|||:||
  Fly   247 VTSYLDWIRDNTGISY 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 112/226 (50%)
Tryp_SPc 40..269 CDD:238113 113/228 (50%)
Jon65AiNP_001286951.1 Tryp_SPc 37..254 CDD:214473 112/226 (50%)
Tryp_SPc 41..257 CDD:238113 111/225 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470832
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 1 1.000 - - H134616
Inparanoid 1 1.050 192 1.000 Inparanoid score I6301
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - mtm9580
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
1110.900

Return to query results.
Submit another query.