DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG13527

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:230 Identity:61/230 - (26%)
Similarity:97/230 - (42%) Gaps:55/230 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 WCGGSIIDNTWVLTAAHCTSGASAV-------TIYYGATVR----TSAQLVQTVSA----DNFVQ 116
            :|||.::.|.||:|||||..|.|.:       .:..|:..|    ....:...||:    .||..
  Fly    61 YCGGGLLSNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTM 125

  Fly   117 HASYNSIVLR-------NDISLIKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDS 174
            |.::|..:::       ||      |.:.|..|  ..|.|.|        |.:....|||:....
  Fly   126 HNTFNMALMKLQEKMPSND------PRIGFLHL--PKEAPKI--------GIRHTVLGWGRMYFG 174

  Fly   175 ATSVANTLQYEVFEVVSVSQCQNTY------GSLVATNNVICV-ATPNKVSTCNGDSGGPLVLVS 232
            .....:..|.:|. ::..:.|: ||      |.:.|.||...: |.|     |:||.|.|  |:|
  Fly   175 GPLAVHIYQVDVV-LMDNAVCK-TYFRHYGDGMMCAGNNNWTIDAEP-----CSGDIGSP--LLS 230

  Fly   233 DSKLIGVTSFVSSAGCESGAPAGFTRVTSYLDWIK 267
            ...::|:.::....|| :..|:.:|.|.|.|.||:
  Fly   231 GKVVVGIVAYPIGCGC-TNIPSVYTDVFSGLRWIR 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 59/227 (26%)
Tryp_SPc 40..269 CDD:238113 61/230 (27%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 61/230 (27%)
Tryp_SPc 43..263 CDD:214473 59/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.