DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Prss48

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001001650.1 Gene:Prss48 / 368202 MGIID:2685865 Length:312 Species:Mus musculus


Alignment Length:266 Identity:77/266 - (28%)
Similarity:119/266 - (44%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHC---T 85
            |:|          .|||..|:.|..|::|:||.|.|..|..   ||||:|.:.||||||||   |
Mouse    34 PVH----------TGRIVGGQDAALGRWPWQVSLRFDYTHS---CGGSLISDHWVLTAAHCIKKT 85

  Fly    86 SGASAVTIYYGATVRTSAQ-----LVQTVSADNFVQHASYNSIVLRNDISLIK-TPTVAFTALIN 144
            ..:...:::.|:..|..:.     .|..::..:..:|.       ..||:|:| :..|.|:::|.
Mouse    86 WYSFLYSVWLGSIDREYSSTGKEYYVSRIAIPDKHRHT-------EADIALLKLSSRVTFSSVIL 143

  Fly   145 KVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSL------- 202
            .:.||.|:...:  .......:|||:..:.  ...:|||.....|:|...|:..|..:       
Mouse   144 PICLPNISKQLT--VPASCWVTGWGQNQEG--HYPSTLQELEVPVISSEACEQLYNPIGVFLPDL 204

  Fly   203 --VATNNVICVA-TPNKVSTCNGDSGGPLVLVSDS--KLIGVTSFVSSAGCESG--APAGFTRVT 260
              |...::.|.. ..::..:|.|||||||....|.  :|:||.|:    |.|.|  .|..:|.||
Mouse   205 ERVIKEDMFCAGERQSRKDSCKGDSGGPLSCHIDGVWRLMGVVSW----GLECGKDLPGVYTNVT 265

  Fly   261 SYLDWI 266
            .|..||
Mouse   266 YYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 72/249 (29%)
Tryp_SPc 40..269 CDD:238113 73/250 (29%)
Prss48NP_001001650.1 Tryp_SPc 39..271 CDD:214473 72/249 (29%)
Tryp_SPc 40..274 CDD:238113 73/250 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.