DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG12133

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:265 Identity:76/265 - (28%)
Similarity:114/265 - (43%) Gaps:45/265 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGKTATSGQFPYQVGLSF----ASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVR 100
            |..|..|.|.|||:.|.|.:    |....|..|.||:|.:.:|||||||.:    |..:|.|.||
  Fly    62 IVGGMEAQSNQFPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLN----VNDFYVARVR 122

  Fly   101 TSAQLVQT--------------------VSADNFVQHASYNSIVLR--NDISLIKTPT-VAFTAL 142
            ......:.                    :..|..|.|..|.:...|  |||:|::..: |.:|..
  Fly   123 LGEHDTENDPDYTWLPNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQ 187

  Fly   143 INKVEL-PAIAGTYSTYTGQQAIASGWGKTSDSATSVANT-LQYEVFEVVSVSQCQNTYGSLVAT 205
            |..:.: |.|..:.|::.......:|||   ||.....:| |:......:|..:|.|.|.:|:..
  Fly   188 IRPICIWPGIELSTSSFKNFPFQIAGWG---DSGLQQKSTVLRQGTISGMSPDECLNRYPTLLVD 249

  Fly   206 NNV-ICVATPNKVSTCNGDSGGPLVLVSDSK-------LIGVTSFVSSAGCESGAPAGFTRVTSY 262
            .:: ||....:...|..||||.|| :.|..:       |.|:||:..........||.:|:.:||
  Fly   250 KDIQICAMGWDGTDTGLGDSGSPL-MASVGRGADQFYYLAGITSYGGGPSSYGYGPAVYTKTSSY 313

  Fly   263 LDWIK 267
            .:|||
  Fly   314 YEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 73/262 (28%)
Tryp_SPc 40..269 CDD:238113 76/265 (29%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 76/265 (29%)
Tryp_SPc 62..317 CDD:214473 73/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436222
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.