DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and PRSS41

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:250 Identity:69/250 - (27%)
Similarity:113/250 - (45%) Gaps:25/250 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 IEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSG---ASAVTIYYG- 96
            |...:..|..:..|::|:|..|.......   ||||::...|||:||||...   .|..|:..| 
Human    67 IHALVAGGVESARGRWPWQASLRLRRRHR---CGGSLLSRRWVLSAAHCFQKHYYPSEWTVQLGE 128

  Fly    97 ATVRTSAQLVQTVSADNFVQHASYNSI---VLRNDISLIK-TPTVAFTALINKVELPAIAGTYST 157
            .|.|.:...::..|:...||....|..   ||||||:|:: ..:|.:.|.|..:.:.  :.|::.
Human   129 LTSRPTPWNLRAYSSRYKVQDIIVNPDALGVLRNDIALLRLASSVTYNAYIQPICIE--SSTFNF 191

  Fly   158 YTGQQAIASGWGKTSDSATSVA---NTLQYEVFEVVSVSQC-----QNTYGSLVATNNVICVATP 214
            ........:|||..|.|.|.:.   |..:.:| .:::.::|     |.:..|::..:.....|..
Human   192 VHRPDCWVTGWGLISPSGTPLPPPYNLREAQV-TILNNTRCNYLFEQPSSRSMIWDSMFCAGAED 255

  Fly   215 NKVSTCNGDSGGPLVLVSDS--KLIGVTSFVSSAGCESGAPAGFTRVTSYLDWIK 267
            ..|.||.||||||||...|.  ..:|:.|:....| :...|..:|.::.|..||:
Human   256 GSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCG-QPNRPGVYTNISVYFHWIR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 66/244 (27%)
Tryp_SPc 40..269 CDD:238113 68/245 (28%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.