DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and try-9

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:258 Identity:58/258 - (22%)
Similarity:89/258 - (34%) Gaps:76/258 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAH-----------CTSGASAVT 92
            ||::|    ||.| ...|..|:.........|:::....::||||           |.:| :...
 Worm     4 RISDG----SGSF-RNGGNKFSENEFVQHGTGTLVSPWHIVTAAHLIGISEDPLPDCDTG-NLRE 62

  Fly    93 IYYGATVRTSAQLVQTVSA------------------------------DNFVQHASYNSIV--- 124
            .|:....:.....|....|                              |..:...|:|.|.   
 Worm    63 AYFVRDYKNFVAFVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFE 127

  Fly   125 LRNDISLIKTPTVAFTA-LINKVELPAIAGT-YSTYTGQQAIASGWGK-TSDSATSVANTLQYEV 186
            |...|...|.   .|.| |.:..::|.|..| |..:        |:|: .|||............
 Worm   128 LEEPIEFSKD---IFPACLPSAPKIPRIRETGYKLF--------GYGRDPSDSVLESGKLKSLYS 181

  Fly   187 FEVVSVSQCQN--TYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDSKLIGVTSFVSSAG 247
            |    |::|.:  .||      .|.|.:..|:..:|:||||..:|..||::.:.|...|.|||
 Worm   182 F----VAECSDDFPYG------GVYCTSAVNRGLSCDGDSGSGVVRTSDTRNVQVLVGVLSAG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 58/258 (22%)
Tryp_SPc 40..269 CDD:238113 57/257 (22%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 50/227 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.