DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and scaf

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:276 Identity:65/276 - (23%)
Similarity:103/276 - (37%) Gaps:70/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PIHPRDLPAVTNIEGRITNGK--TATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTS 86
            |::...:.|..|...:.|..|  .|...:.|:| .:....:|.:..|||:||.:.:||::|.|.:
  Fly   405 PVNLAGVCATRNKRTKPTGVKDLDANFAEIPWQ-AMILRESSKTLICGGAIIGDQFVLSSASCVN 468

  Fly    87 GASAVTIYYGATVRTSA--------------QL--VQTVSADNFVQHASYNSIVLRNDISLIKTP 135
            |.....|      |..|              ||  |:||..     |..|:.....:|:::|:  
  Fly   469 GLPVTDI------RVKAGEWELGSTNEPLPFQLTGVKTVDV-----HPDYDPSTNSHDLAIIR-- 520

  Fly   136 TVAFTALINKVEL-----PAIAGTYSTYTGQQAIASGWGKTS------DSATSVANTLQYEVFEV 189
                  |..::|.     |...........:|...|||||.:      .:...|.:||..     
  Fly   521 ------LERRLEFASHIQPICISDEDPKDSEQCFTSGWGKQALSIHEEGALMHVTDTLPQ----- 574

  Fly   190 VSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDS--KLIGVTSFVSSAGCESGA 252
             :.|:|.       |.::.:|.||  |..:|..|.|..|...|.|  :|.|:  |.....|..|.
  Fly   575 -ARSECS-------ADSSSVCSAT--KFDSCQFDVGSALACGSGSSVRLKGI--FAGENSCGEGQ 627

  Fly   253 PAGFTRVTSYLDWIKT 268
            ...|.:..  :.||.|
  Fly   628 TVRFAKPD--IKWINT 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 59/257 (23%)
Tryp_SPc 40..269 CDD:238113 62/260 (24%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 52/222 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435401
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.