DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG17572

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:279 Identity:66/279 - (23%)
Similarity:110/279 - (39%) Gaps:45/279 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PIHPRDLPAVTNIEGRITNGKTATSGQFPY--QVGLSFASTSG-SWWCGGSIIDNTWVLTAAHC- 84
            |:....:...:.::|....|    .|.:|:  ::|....:|.. ::.|.|::|....:|||||| 
  Fly   117 PLEKNQVCGKSLVQGHFYKG----LGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCA 177

  Fly    85 ---TSGASAVTIYYG----------ATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISL--IKT 134
               ..|....::..|          |.....|......:..:.:.|..|......:||:|  :||
  Fly   178 LAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKT 242

  Fly   135 P---TVAFTAL-INKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQC 195
            |   :||...: :.|.....:       .|::|..:||||.|.|:.........:| .:.|...|
  Fly   243 PLNYSVATQPICLQKTRANLV-------VGKRATIAGWGKMSTSSVRQPEMSHLDV-PLTSWDLC 299

  Fly   196 QNTYGS---LVATNNV----ICVATPNKVSTCNGDSGGPLVLVSDS--KLIGVTSFVSSAGCESG 251
            ...|||   |.:.|::    :|.....| ..|.|..|.||.:..:.  ..||:.||.|.......
  Fly   300 LRNYGSTGALESPNSIEGQWMCAGGEGK-DVCQGFGGAPLFIQENGIFSQIGIMSFGSDNCGGLR 363

  Fly   252 APAGFTRVTSYLDWIKTNT 270
            .|:.:|.|..:.:||..||
  Fly   364 IPSVYTSVAHFSEWIHDNT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 60/258 (23%)
Tryp_SPc 40..269 CDD:238113 62/260 (24%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 61/251 (24%)
Tryp_SPc 138..378 CDD:214473 59/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.