DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG9377

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:252 Identity:56/252 - (22%)
Similarity:96/252 - (38%) Gaps:50/252 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 ATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTI-----YYGATVRTSAQL 105
            |..|:||:.|.:..:.|   :.|.|::|....|:|.|||...:....:     .:.|.|....|.
  Fly   107 AKFGEFPWLVAVYGSDT---YLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQP 168

  Fly   106 VQTVSADNFVQHASYNSIVLRNDISLIKTPTVAFTALINK--------------VELPAIAGTYS 156
            .|..|....:.|.:|..:.|.::|:::         |::|              :..|.|...||
  Fly   169 HQQRSVVETLVHPNYTQMPLAHNIAIL---------LVDKEKPFQLAPNVQPICLPPPRIMYNYS 224

  Fly   157 TYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQ-----NTYGSLVATNNVICVATPNK 216
                 |...||| :.||...:.....::.:: |:...||:     :..|...|.|:.:..|..:|
  Fly   225 -----QCYVSGW-QRSDFGRAAILPKRWTLY-VLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDK 282

  Fly   217 VSTCNGD---SGGPLVLV---SDSKLIGVTSFVSSAGCESGAPAG-FTRVTSYLDWI 266
            .....||   :..||:..   .|.:.........:|.|:.....| :|.|..|..||
  Fly   283 GDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWI 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 54/250 (22%)
Tryp_SPc 40..269 CDD:238113 56/252 (22%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 56/252 (22%)
Tryp_SPc 105..339 CDD:214473 54/250 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.