DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and prss60.3

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:290 Identity:101/290 - (34%)
Similarity:138/290 - (47%) Gaps:34/290 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKV--LVVFALALATASAGLLPQ-----QVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLS 58
            ||:  |....|.|.....|.|.|     |.|::.           ||..|..|:.|.:|:||.| 
Zfish     1 MKMWRLTCATLTLLICVKGSLSQLNVCGQAPLNT-----------RIVGGVNASPGSWPWQVSL- 53

  Fly    59 FASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVT--IYYGATVRTSAQLVQTVS--ADNFVQHAS 119
            .:...|..:||||:|.:.||||||||.||.|..|  :|.|...:....:.:|..  |.:|| |:|
Zfish    54 HSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVVYLGRRTQQGINIYETSRNVAKSFV-HSS 117

  Fly   120 YNSIVLRNDISLIK-TPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVA-NTL 182
            |||....|||:|:: :..|.||..|..|.|.|....||  .|..:..:|||.........| ..|
Zfish   118 YNSNTNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYS--AGTSSWITGWGDIQAGVNLPAPGIL 180

  Fly   183 QYEVFEVVSVSQCQNTYGSLVATNNVICVA-TPNKVSTCNGDSGGPLV--LVSDSKLIGVTSFVS 244
            |..:..||:..:|....||...|||:||.. |.....||.||||||:|  |.:.....|:||:  
Zfish   181 QETMIPVVANDRCNALLGSGTVTNNMICAGLTQGGKDTCQGDSGGPMVTRLCTVWVQAGITSW-- 243

  Fly   245 SAGC-ESGAPAGFTRVTSYLDWIKTNTGVS 273
            ..|| :..:|..:|||:.|..||.:...::
Zfish   244 GYGCADPNSPGVYTRVSQYQSWISSKISLN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 89/236 (38%)
Tryp_SPc 40..269 CDD:238113 90/238 (38%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 90/238 (38%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.