DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and ela2l

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_956180.1 Gene:ela2l / 334304 ZFINID:ZDB-GENE-040511-1 Length:267 Species:Danio rerio


Alignment Length:284 Identity:97/284 - (34%)
Similarity:137/284 - (48%) Gaps:37/284 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLVVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGS 65
            ||.:|:..|.:...|.||     |..|   |.||    |:..|.......:|:|:.|.:.|.| :
Zfish     2 MKFVVLAVLVVGAYSCGL-----PTFP---PIVT----RVVGGVDVRPNSWPWQISLQYKSGS-N 53

  Fly    66 WW--CGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTSAQLVQ------TVSADNFVQHASYNS 122
            |:  ||||:||..||||||||.|.:....::.|     ...|.|      .:.|...:.|.::||
Zfish    54 WYHTCGGSLIDKQWVLTAAHCISSSRTYRVFLG-----KHSLSQEENGSVAIGAGKIIVHEAWNS 113

  Fly   123 IVLRNDISLIKTPT-VAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEV 186
            ..:||||:|||..| |.....|....||. || |..........:|||:...:. .:|:.||..:
Zfish   114 FTIRNDIALIKLETAVTIGDTITPACLPE-AG-YVLPHNAPCYVTGWGRLYTNG-PLADILQQAL 175

  Fly   187 FEVVSVSQCQNT--YGSLVATNNVICVATPNKVSTCNGDSGGPLVLV-SDS--KLIGVTSFVSSA 246
            ..||..:.|..:  :||.| |.:::|......|:.|:|||||||... ||.  ::.|:.||.|..
Zfish   176 LPVVDHATCSKSDWWGSQV-TTSMVCAGGDGVVAGCDGDSGGPLNCAGSDGAWEVHGIVSFGSGL 239

  Fly   247 GCE-SGAPAGFTRVTSYLDWIKTN 269
            .|. :..|..||||::|.|||..|
Zfish   240 SCNYNKKPTVFTRVSAYSDWISKN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 82/241 (34%)
Tryp_SPc 40..269 CDD:238113 83/243 (34%)
ela2lNP_956180.1 Tryp_SPc 28..260 CDD:214473 82/241 (34%)
Tryp_SPc 29..263 CDD:238113 83/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.