DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Prss34

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:272 Identity:76/272 - (27%)
Similarity:118/272 - (43%) Gaps:51/272 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWW---CGGSIIDNTWVLTAAHCTSGASA 90
            ||.:...:.| |..|...::.:||:||.|.......|.|   ||||:|...||||||||......
Mouse    25 DLGSGQGLVG-IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVRPKEV 88

  Fly    91 VTIYYGATVRT-------SAQLVQTVSADNFVQHASYNSIVLRN---DISLIKTPT-VAFTALIN 144
            ..  ||..|:.       :.||::.|   ..::|..::..:...   ||:|:|..| |..:..:.
Mouse    89 EA--YGVRVQVGQLRLYENDQLMKVV---KIIRHPKFSEKLSARGGADIALLKLDTRVVLSEHVY 148

  Fly   145 KVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTL----QYEVFEV----VSVSQCQNTY-- 199
            .|.|||.:...|  :.:....:|||       .:.|.:    .|.:.||    |..:.|:..|  
Mouse   149 PVSLPAASLRIS--SKKTCWVAGWG-------VIENYMPLPPPYHLREVAVPIVENNDCEQKYQT 204

  Fly   200 ------GSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDSK--LIGVTSFVSSAGCE-SGAPAG 255
                  .:.:..::::|.....: .:|..|||||||...:..  .:||.|:  ..||. ...|..
Mouse   205 NSSSDSTTRIIKDDMLCAGKEGR-DSCKADSGGPLVCRWNCSWVQVGVVSW--GIGCGLPDFPGV 266

  Fly   256 FTRVTSYLDWIK 267
            :|||.||:.|||
Mouse   267 YTRVMSYVSWIK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 70/259 (27%)
Tryp_SPc 40..269 CDD:238113 73/261 (28%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 71/259 (27%)
Tryp_SPc 35..277 CDD:214473 70/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.