DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG31220

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:280 Identity:74/280 - (26%)
Similarity:114/280 - (40%) Gaps:58/280 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PAVTNIEGRITNGKTATSGQFPYQVGLSFASTSG---------SWWCGGSIIDNTWVLTAAHC-- 84
            |..||   |:..|......::|:...|.:.:.|.         |  ||||:|:..:|||||||  
  Fly    98 PQTTN---RVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPS--CGGSLINTRYVLTAAHCVT 157

  Fly    85 --------------TSGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYN--SIVLRNDISLI- 132
                          |:..:...|..||.: ..|.....:..::...|..|:  :...||||:|: 
  Fly   158 DTVLQIQRVRLGEHTTSHNPDCISRGARI-VCAPTHLDIDVESITSHNDYDPANYTFRNDIALVR 221

  Fly   133 -KTP---TVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTS--DSATSVANTLQYEVFEVVS 191
             |.|   |:|:.. |..::.|.....:..|      .:|||||.  |:.:.|   |::...:|..
  Fly   222 LKEPVRYTMAYYP-ICVLDYPRSLMKFKMY------VAGWGKTGMFDTGSKV---LKHAAVKVRK 276

  Fly   192 VSQCQNTYGSL-VATNNVICVATPNKVSTCNGDSGGPLVLVSDSK------LIGVTSFVSSAGCE 249
            ..:|...|... ......||....:...||:||||.||:..|...      |.|:||:....| .
  Fly   277 PEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITFLAGITSYGGPCG-T 340

  Fly   250 SGAPAGFTRVTSYLDWIKTN 269
            .|.|:.|||...:..||:.:
  Fly   341 IGWPSVFTRTAKFYKWIRAH 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 69/267 (26%)
Tryp_SPc 40..269 CDD:238113 70/269 (26%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 69/267 (26%)
Tryp_SPc 104..360 CDD:238113 70/269 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436217
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.