DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG8952

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:260 Identity:93/260 - (35%)
Similarity:141/260 - (54%) Gaps:17/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSW---WCGGSIIDNTWVLTAAHCT 85
            |..|.:...: .|:.||.:|..|..||||:||.|.    ..:|   .||||||.:||||||||||
  Fly    23 PFDPANSSPI-KIDNRIVSGSDAKLGQFPWQVILK----RDAWDDLLCGGSIISDTWVLTAAHCT 82

  Fly    86 SGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIKTP-TVAFTALINKVELP 149
            :|.|::.:.:|.....:|..: .::::|.:.|..||. .|.||:|||:.| .:.|:|.|..::|.
  Fly    83 NGLSSIFLMFGTVDLFNANAL-NMTSNNIIIHPDYND-KLNNDVSLIQLPEPLTFSANIQAIQLV 145

  Fly   150 AIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVA-- 212
            ...|....|.|..|..:|:|.|.|.....:.||.|...|::..:.|...||..|..::.:|..  
  Fly   146 GQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIIDNADCVAIYGKYVVVDSTMCAKGF 210

  Fly   213 TPNKVSTCNGDSGGPLVL----VSDSKLIGVTSFVSSAGCESGAPAGFTRVTSYLDWIKTNTGVS 273
            ..:.:|||.|||||||:|    :...:.||:.|||:...|....|:|:.||:|:|.:|...||::
  Fly   211 DGSDMSTCTGDSGGPLILYNKTIQQWQQIGINSFVAEDQCTYRLPSGYARVSSFLGFIADKTGIA 275

  Fly   274  273
              Fly   276  275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 87/236 (37%)
Tryp_SPc 40..269 CDD:238113 87/238 (37%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 87/236 (37%)
Tryp_SPc 38..271 CDD:238113 87/238 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471051
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 1 0.900 - - E33208_3BBU3
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 1 1.000 - - otm50958
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.