DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and sphinx1

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:294 Identity:71/294 - (24%)
Similarity:117/294 - (39%) Gaps:61/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLVVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSF--ASTS 63
            ||::|...:...|.|.|   ::..:.|           ||..|..|.:....|.||:.:  :.||
  Fly     1 MKLVVTLLVLSLTVSVG---EKNKLSP-----------RIAGGYRAKTFTIIYLVGIVYFKSQTS 51

  Fly    64 GSWWCGGSIIDNTWVLTA----------AHCTS-----GASAVTIYYGATVRTSAQLVQTVSADN 113
            ...:..|:||.|.|:||.          .|..|     |...:.||                .:|
  Fly    52 SLNYGAGTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDIIRIY----------------KEN 100

  Fly   114 FVQHASYNSIVLRND--ISLIKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSAT 176
            |..|  |:     ||  |:|:|.|...|...:::|.:||....:..|.|...:..|:| |.....
  Fly   101 FRFH--YD-----NDHVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYG-TEKRHA 157

  Fly   177 SVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVS-DSKLIGVT 240
            .:...::....||::.::|...|..|....  :|.:.......|.||.||.:|.:. :...||:.
  Fly   158 KLPEWMRCIEVEVMNNTECAKYYTPLKWYE--MCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGII 220

  Fly   241 SFVSSAGCESGAPAGFTRVTSYLDWIKTNTGVSY 274
             ::....|..|.|:...||:.::.|||..:||.:
  Fly   221 -WLMPENCSIGYPSVHIRVSDHIKWIKRVSGVGF 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 59/246 (24%)
Tryp_SPc 40..269 CDD:238113 61/248 (25%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 59/246 (24%)
Tryp_SPc 26..248 CDD:304450 61/248 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471010
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.