DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and spirit

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:251 Identity:77/251 - (30%)
Similarity:114/251 - (45%) Gaps:43/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ITNGKTATSGQFPYQVGLSFASTSGS---WWCGGSIIDNTWVLTAAHCTS-----------GASA 90
            :..|......:||:...|.:.|....   :.|||::|.|.:|||||||..           |...
  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196

  Fly    91 VTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIKTPTVAFTALINKVEL-PAIAGT 154
            :|:..|          :.:|....:.|..|::....|||:|::..|.|      |.|| |....|
  Fly   197 LTLTEG----------EDISIRRVIIHPDYSASTAYNDIALLELETAA------KPELKPTCIWT 245

  Fly   155 YSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVI----CVA-TP 214
            ....|.....|.|:|:||.:..|.|..|:..: :.||..:||:.|........|:    |.. ..
  Fly   246 QKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPL-KSVSNEECQHHYQKDQLAQGVLGTQMCAGDIT 309

  Fly   215 NKVSTCNGDSGGPLVLVSDSKL---IGVTSFVSSAGCESGAPAGFTRVTSYLDWIK 267
            .:..||.||||||| |:.|..|   :|:||.  ..||.||.|:.:|||:|::|||:
  Fly   310 GERDTCQGDSGGPL-LMQDGLLGYVVGITSL--GQGCASGPPSVYTRVSSFVDWIE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 75/248 (30%)
Tryp_SPc 40..269 CDD:238113 77/251 (31%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 77/251 (31%)
Tryp_SPc 132..361 CDD:214473 75/248 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437031
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.