DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and C1s2

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_776289.2 Gene:C1s2 / 317677 MGIID:3644269 Length:694 Species:Mus musculus


Alignment Length:280 Identity:80/280 - (28%)
Similarity:120/280 - (42%) Gaps:49/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PRDLPAV------TNIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCT 85
            ||.:|..      ..::.:|..|:.|....||:||..:..:      .||::|:..|||||||..
Mouse   425 PRCIPVCGVPTEPFQVQQKIFGGQPAKIENFPWQVFFNHPT------AGGALINEYWVLTAAHVV 483

  Fly    86 SGASAVTIYYGATVRTSAQL--VQTVSADNFVQHASYNS-------IVLRNDISLI--KTPTVAF 139
            ...|..::|.|.|....|.|  .|.:.....:.|..:..       ....|||:|:  |.| |..
Mouse   484 EKNSDPSMYAGITALRLADLENAQRLYTKRVIIHPGWKEDDDLNPRTNFDNDIALVQLKDP-VKM 547

  Fly   140 TALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTY----- 199
            ....:.:.||..:..|:...|...:.||||:| :....|.| |:.....|.|:..|:...     
Mouse   548 GPKFSPICLPGTSSEYNLSPGDMGLISGWGRT-EKRLHVIN-LRGAKVPVTSLETCKQVKEENPT 610

  Fly   200 ---GSLVATNNVICVATPNKVSTCNGDSGG------PLVLVSDSKLIGVTSFVSSAGCESGAPAG 255
               ...|.|:|:|| |....|.:|.|||||      |.|......:.|:.|:    |.:.||...
Mouse   611 ARPEDYVITDNMIC-AGEKGVDSCKGDSGGAFAFQVPNVKAPKFYVAGLVSW----GKKCGAYGV 670

  Fly   256 FTRVTSYLDWI-KT---NTG 271
            :|:|.:|:||| ||   |:|
Mouse   671 YTKVKNYVDWILKTMQENSG 690

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 71/251 (28%)
Tryp_SPc 40..269 CDD:238113 75/257 (29%)
C1s2NP_776289.2 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:291342
CUB 181..293 CDD:278839
CCP 300..361 CDD:153056
CCP 365..428 CDD:153056 2/2 (100%)
Tryp_SPc 443..681 CDD:214473 71/251 (28%)
Tryp_SPc 444..684 CDD:238113 73/253 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.