DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Prss30

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:290 Identity:88/290 - (30%)
Similarity:129/290 - (44%) Gaps:43/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVFALALATASAG----------LLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSF 59
            :|..|.|..:.||          :|| .|..|.||       .|:|..|:.|..||:|:||.|..
Mouse    37 IVDGLTLRRSYAGFFYNGWARGDILP-SVCGHSRD-------AGKIVGGQDALEGQWPWQVSLWI 93

  Fly    60 ASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYY----GATVRTSAQLVQTVSADNFVQHASY 120
              |.....||||:|...||||||||...:...:.|:    |.|:.........|:..|...|.:|
Mouse    94 --TEDGHICGGSLIHEVWVLTAAHCFRRSLNPSFYHVKVGGLTLSLLEPHSTLVAVRNIFVHPTY 156

  Fly   121 N-SIVLRNDISLIKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQY 184
            . :.....||:|::..|....:....|.||| |.|..| .|.....:|||.|.:  ..:|:.||.
Mouse   157 LWADASSGDIALVQLDTPLRPSQFTPVCLPA-AQTPLT-PGTVCWVTGWGATQE--RDMASVLQE 217

  Fly   185 EVFEVVSVSQCQNTY--------GSLVATNNVICVA-TPNKVSTCNGDSGGPLVLVSDSK--LIG 238
            ....::....|:..|        |..:..::::|.. ...:..:|.||||||||...:|.  .:|
Mouse   218 LAVPLLDSEDCEKMYHTQGSSLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVG 282

  Fly   239 VTSFVSSAGC-ESGAPAGFTRVTSYLDWIK 267
            :||:  ..|| ....|..:|||.:|:|||:
Mouse   283 ITSW--GIGCARPYRPGVYTRVPTYVDWIQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 74/243 (30%)
Tryp_SPc 40..269 CDD:238113 76/245 (31%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 76/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.