DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Prss34

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:279 Identity:84/279 - (30%)
Similarity:117/279 - (41%) Gaps:50/279 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWW---CGGSIIDNTWVLT 80
            |...:|:.|.....:..|.|    |...::.:||:||.|.|.:...|.|   ||||:|...||||
  Rat    16 LGSTMPLTPDSGQELVGIVG----GCPVSASRFPWQVSLRFYNMKLSKWEHICGGSLIHPQWVLT 76

  Fly    81 AAHCTS----GASAVTIYYG-ATVRTSAQLVQTVSADNFVQHASYN---SIVLRNDISLIK-TPT 136
            ||||..    .||...:..| ..:..:.||::..   ..::|..::   |.....||:|:| ..|
  Rat    77 AAHCVELKEMEASCFRVQVGQLRLYENDQLMKVA---KIIRHPKFSEKLSAPGGADIALLKLDST 138

  Fly   137 VAFTALINKVELPAIAGTYSTYTGQQAIAS-------GWGKTSDSATSVANTLQYEV-FEVVSVS 193
            |..:..::.|.|||         ..|.|:|       |||...............|| ..:|..|
  Rat   139 VVLSERVHPVSLPA---------ASQRISSKKTWWVAGWGVIEGHRPLPPPCHLREVAVPIVGNS 194

  Fly   194 QCQ---NTYGSLVATNNVI-----CVATPNKVSTCNGDSGGPLVLVSDSK--LIGVTSFVSSAGC 248
            .|:   .||.||..|..:|     |.....: .:|..|||||||...:..  .:||.|:  ..||
  Rat   195 DCEQKYRTYSSLDRTTKIIKDDMLCAGMEGR-DSCQADSGGPLVCRWNCSWVQVGVVSW--GIGC 256

  Fly   249 E-SGAPAGFTRVTSYLDWI 266
            . ...|..:|||.|||.||
  Rat   257 GLPDFPGVYTRVMSYLSWI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 77/257 (30%)
Tryp_SPc 40..269 CDD:238113 79/258 (31%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 81/262 (31%)
Tryp_SPc 33..275 CDD:214473 79/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.