DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG33462

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:265 Identity:69/265 - (26%)
Similarity:109/265 - (41%) Gaps:60/265 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGA-T 98
            ||..|..|.|.|   |.|:   :::..|...:.|.|::|::.:|||||||......:|:..|. .
  Fly    34 NISERSVNAKLA---QNPW---MAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYN 92

  Fly    99 VRTSA--------QLVQTVSADNFVQHASYNSIVLRNDISLIK-----------TPTVAFTALIN 144
            .:|..        :..|..:.|...:|..||:....|||.:::           .|...|.:  |
  Fly    93 TKTKVDCDNHLCQEPFQEYNVDMGFRHRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFAS--N 155

  Fly   145 KVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQ-----CQNTYGSLVA 204
            :.:.|....|:.|.|       .|.:|:.:|||       :|...:::.:     |...||..: 
  Fly   156 RFQEPIDQLTWFTTT-------VWRETAANATS-------KVLRTMNIDRQPKETCSEIYGWNM- 205

  Fly   205 TNNVICVATPNKVS-TCNGDSGGPLVLV-----SDSKL-IGVTSFVSSAGCESGAPAGFTRVTSY 262
            |...||..  |.:| .|:.|||.|.:..     ||..: :|:.|.|......||.   ...:.||
  Fly   206 TFEQICAG--NTLSQLCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNSGI---LMDLLSY 265

  Fly   263 LDWIK 267
            .||||
  Fly   266 ADWIK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 64/258 (25%)
Tryp_SPc 40..269 CDD:238113 66/260 (25%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 62/248 (25%)
Tryp_SPc 48..269 CDD:214473 59/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436240
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.