DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG30323

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_725729.2 Gene:CG30323 / 246539 FlyBaseID:FBgn0050323 Length:306 Species:Drosophila melanogaster


Alignment Length:252 Identity:43/252 - (17%)
Similarity:80/252 - (31%) Gaps:67/252 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 WCGGSIIDNTWVLTAAHCTS---------------------------GASAVTIYY--------- 95
            :|.||::...||:|:..|.|                           ..|...||:         
  Fly    53 FCAGSLLSAWWVVTSGCCVSTRPESTPNQPSNRKNLRVVVFTPKRLKKPSPKNIYHVQKIVLDES 117

  Fly    96 ---GATVRTSAQLVQTVSADNF---VQHASYNSIVLRNDISLIKTPTVAFTALINKVELPAIAGT 154
               |.|.....:|.:.|:...|   :.....||..|.|.:...:...|::..:  ....||.:..
  Fly   118 AISGCTELALLKLDRGVTGQRFAMMLPEKELNSTWLCNSLGWGRIYYVSYVYI--SAMCPAFSMV 180

  Fly   155 YSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVAT-PNKVS 218
            |..       ...|.:....::.:......::.|......|          :..:|:.: ..:.:
  Fly   181 YDN-------PVTWFQDGPYSSELIQIRAQKISEYECKPDC----------SRCLCMTSYTGRGN 228

  Fly   219 TCNGDSGGPLVLVSDSKLIGVTSFVSSAGCESGAPAGFTRVTSYLDWIK-TNTGVSY 274
            .|..|.|.|  |..|..|.||...|.:  |:......:|.:.....:|: |.:|.::
  Fly   229 MCQQDLGSP--LFCDHFLYGVARRVHT--CDDEGFMFYTNIYQNRKFIEDTLSGATW 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 40/241 (17%)
Tryp_SPc 40..269 CDD:238113 41/245 (17%)
CG30323NP_725729.2 Tryp_SPc 45..275 CDD:304450 41/244 (17%)
Tryp_SPc 45..272 CDD:214473 40/241 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471268
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.