DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG30286

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:283 Identity:70/283 - (24%)
Similarity:123/283 - (43%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLPQQVPIHPR-------------DLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCG 69
            ||...:|.||.             ...|:.|.|.:      |...:.|:   :::...||...||
  Fly     6 LLTSLLPWHPHATAQFLEPDCGYMSPEALQNEEHQ------AHISESPW---MAYLHKSGELVCG 61

  Fly    70 GSIIDNTWVLTAAHCTSGASAVTIYYGA-TVRTSAQL--------VQTVSADNFVQHASYNSIVL 125
            |:::::.::||||||......:|:..|. ...||...        .:....|...:|..|:....
  Fly    62 GTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNR 126

  Fly   126 RNDISLIK-TPTVAFTALINKVEL-------PAIAGTYSTYTGQQAIASGWGKT-SDSATSVANT 181
            .:||.|:: ..:|.:...|..:.|       |.|...:      :.:|:|||:: |::|..:..:
  Fly   127 IHDIGLLRLAKSVEYKVHIKPICLITNTTLQPKIERLH------RLVATGWGRSPSEAANHILKS 185

  Fly   182 LQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPL--VLVSDSKLIGV-TSFV 243
            ::   ...|:...|..||. :....:.|||:..:.|| |:||||||:  .:..|.:::.| ...|
  Fly   186 IR---VTRVNWGVCSKTYW-VDRRRDQICVSHESGVS-CSGDSGGPMGQAIRLDGRVLFVQVGIV 245

  Fly   244 SSAGCESGAPAGFTRVTSYLDWI 266
            |....|..:|:.||.|..::|||
  Fly   246 SYGNAECLSPSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 60/247 (24%)
Tryp_SPc 40..269 CDD:238113 62/248 (25%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 62/250 (25%)
Tryp_SPc 39..268 CDD:214473 60/248 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436236
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.