DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG30187

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:253 Identity:72/253 - (28%)
Similarity:105/253 - (41%) Gaps:42/253 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATV 99
            ||..:||.|..|.   |...|.::.......:.|||::|...:|||||||.......::..||..
  Fly    31 NIALKITGGHNAA---FQNSVWMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQDVQSVSLGAYN 92

  Fly   100 RTS----AQLVQTVSADNFVQHASYNSIVLRNDISLIK-TPTVAFTALINKVELPAIAGTYSTYT 159
            ::.    ..::..|...:|...|||     .|||.|:| :..|.|.|||..:.:.......:...
  Fly    93 KSDPADRKDVITAVVHSSFDVRASY-----ENDIGLLKLSSDVIFNALIRPICIVLNKSMANHMR 152

  Fly   160 GQQAI-ASGWG-----KTSD-SATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNKV 217
            ..:.. |.|||     |||| ..|.:.|.|..|        :|.... |:..:...||...|:. 
  Fly   153 NMRTFKAFGWGTLRGNKTSDILQTIILNHLDRE--------ECYMEL-SVYPSEKQICAGVPSG- 207

  Fly   218 STCNGDSGGPLVLVSDSKLIGVTS--------FVSSAGCESGAPAGFTRVTSYLDWIK 267
            .||.||||||  |.:|..:.|:.:        .|....|:  ....:|.:.|:.||||
  Fly   208 DTCGGDSGGP--LTNDVFIQGIGNREVQFGIISVGKTSCD--GQGVYTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 67/246 (27%)
Tryp_SPc 40..269 CDD:238113 70/248 (28%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 67/246 (27%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.