DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG30091

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:292 Identity:73/292 - (25%)
Similarity:114/292 - (39%) Gaps:51/292 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLVVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWW 67
            ||..:.|.....||.||.:...:..:.:|       :|..|..|...:.|:   ::...|:..:.
  Fly     7 VLFAWMLTAGRGSARLLDEDCGVPMQLIP-------KIVGGVDAGELKNPW---MALIKTNDEFI 61

  Fly    68 CGGSIIDNTWVLTAAHC-TSGASAVTIYYGATVRTSAQLVQTVSADNFVQHASYN--------SI 123
            ||||:|.|.:||||||| .:....:..|...||......:......|. .|..||        |.
  Fly    62 CGGSVITNKFVLTAAHCMCTDEECIVKYTQLTVTLGVYHLLATGEHNH-PHEIYNVERVYIHDSF 125

  Fly   124 VL---RNDISLIK-------TPTV-AFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATS 177
            .:   ||||:|::       .|.: ....|:|....|      .|...|:..|.|||.|.:.  .
  Fly   126 AIQNYRNDIALLRLQKSIVYKPQIKPLCILLNDQLKP------QTDLIQEFTAIGWGVTGNG--K 182

  Fly   178 VANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVL------VSDSKL 236
            ::|.||......:....|:..:. ......:.|..|.....||..||||||.:      :..:..
  Fly   183 MSNNLQMVKIYRIDRKMCEAAFW-YTFDYPMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQ 246

  Fly   237 IGVTSFVSSAGCESGAPAG-FTRVTSYLDWIK 267
            :|:.    |.|.|.....| :|.|..::|:|:
  Fly   247 LGIV----STGTEDCRGFGMYTDVMGHIDFIE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 64/253 (25%)
Tryp_SPc 40..269 CDD:238113 65/255 (25%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 64/253 (25%)
Tryp_SPc 37..276 CDD:238113 65/255 (25%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436242
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.