DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG30083

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:245 Identity:71/245 - (28%)
Similarity:117/245 - (47%) Gaps:31/245 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NIEGRITNGKTATSGQFPYQVGLSFASTS--GSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGA 97
            :|..:|.:|:.|.:|..|:...:...:..  ....|||::|...:||:||||......:.:..|.
  Fly    29 DISPKIMHGQNAENGTNPWMAYIFKYNDKEVAELVCGGTLIHKQFVLSAAHCIKRDQILAVRLGE 93

  Fly    98 TVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIK-TPTVAFTALINKVEL---PAIAGTYSTY 158
            ...:....|.....:.:....||:     |||.::: .|.|.|.|:|..:.:   |.......|:
  Fly    94 HSSSRYFAVTKAFRNKYFTTGSYS-----NDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTF 153

  Fly   159 TGQQAIASGWGKT-SDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVICVATPNKVSTCNG 222
            .     |:||||| :::.:.|..|::   ...::.|:|.|.....| |.:.||...|:. .||.|
  Fly   154 K-----AAGWGKTENETFSKVLKTVE---LNELNASECYNMLWVNV-TESQICAGHPDG-DTCAG 208

  Fly   223 DSGGPLV--LVSDSKL----IGVTSFVSSAGCESGAPAGFTRVTSYLDWI 266
            ||||||:  :..|..|    :|:.||.||. |.|  |..:||::|::|||
  Fly   209 DSGGPLIHPVYMDGSLRYVQLGIISFGSSL-CNS--PGVYTRLSSFIDWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 68/239 (28%)
Tryp_SPc 40..269 CDD:238113 70/240 (29%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 68/239 (28%)
Tryp_SPc 34..255 CDD:238113 68/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436229
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.