DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Cela1

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_036684.1 Gene:Cela1 / 24331 RGDID:2547 Length:266 Species:Rattus norvegicus


Alignment Length:259 Identity:89/259 - (34%)
Similarity:127/259 - (49%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 RDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWW--CGGSIIDNTWVLTAAHCTSGASA 90
            :|.|. ||  .|:..|..|....:|.|:.|.:.| .|||:  |||::|...||:|||||.|....
  Rat    18 QDFPE-TN--ARVVGGAEARRNSWPSQISLQYLS-GGSWYHTCGGTLIRRNWVMTAAHCVSSQMT 78

  Fly    91 VTIYYG-ATVRTSAQLVQTVSADNFVQHASYNS--IVLRNDISLIKTPTVAFTALINKVELPAI- 151
            ..:..| ..:..:....|.||....|.|.::||  :....||:|::  ......|.|.|:|..: 
  Rat    79 FRVVVGDHNLSQNDGTEQYVSVQKIVVHPNWNSNNVAAGYDIALLR--LAQSVTLNNYVQLAVLP 141

  Fly   152 -AGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNT--YGSLVATNNVICVAT 213
             .||... .......:|||:|..:. .::.|||......|..|.|.::  :||.|.| .::|...
  Rat   142 QEGTILA-NNNPCYITGWGRTRTNG-QLSQTLQQAYLPSVDYSICSSSSYWGSTVKT-TMVCAGG 203

  Fly   214 PNKVSTCNGDSGGPL-VLVSDSKLI-GVTSFVSSAGCE-SGAPAGFTRVTSYLDWIKTNTGVSY 274
            ....|.|.||||||| .||:....: ||||||||.||. |..|..||||::|:.|:  |..::|
  Rat   204 DGVRSGCQGDSGGPLHCLVNGQYSVHGVTSFVSSMGCNVSRKPTVFTRVSAYISWM--NNVIAY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 82/238 (34%)
Tryp_SPc 40..269 CDD:238113 82/240 (34%)
Cela1NP_036684.1 Tryp_SPc 26..258 CDD:214473 82/237 (35%)
Tryp_SPc 27..262 CDD:238113 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.