DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and TPSD1

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:256 Identity:70/256 - (27%)
Similarity:104/256 - (40%) Gaps:54/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLVVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGS 65
            |..|::.||.:..:.|.:.|.     |......|.|.|    |:.|...::|:||.|   ...|.
Human     8 MLSLLLLALPVLASPAYVAPA-----PGQALQQTGIVG----GQEAPRSKWPWQVSL---RVRGP 60

  Fly    66 WW---CGGSIIDNTWVLTAAHCTS------GASAVT-----IYYGATVRTSAQLVQTVSADNFVQ 116
            :|   ||||:|...||||||||..      .|..|.     :||..         |.:.....:.
Human    61 YWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQD---------QLLPVSRIIV 116

  Fly   117 HASYNSIVLRNDISLIK-TPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVAN 180
            |..:..|....||:|:: ...|..::.|:.|.||..:.|:.  .|.....:|||   |...:|..
Human   117 HPQFYIIQTGADIALLELEEPVNISSHIHTVTLPPASETFP--PGMPCWVTGWG---DVDNNVHL 176

  Fly   181 TLQYEVFE----VVSVSQCQNTYGS--------LVATNNVICVATPNKVSTCNGDSGGPLV 229
            ...|.:.|    ||....|...|.:        .:..::::|..:.|. .:|.||||||||
Human   177 PPPYPLKEVEVPVVENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSENH-DSCQGDSGGPLV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 60/218 (28%)
Tryp_SPc 40..269 CDD:238113 60/217 (28%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 62/221 (28%)
Tryp_SPc 38..240 CDD:214473 62/221 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.