DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and svh-1

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:278 Identity:71/278 - (25%)
Similarity:116/278 - (41%) Gaps:47/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNT 76
            :.:..||  :.|.::.||  |..:...|:..|.....|.||:...|...:|. :..||.||:|.|
 Worm   689 SASQCGL--RYVEVNARD--AAKSRIARVVGGFETVPGAFPWTAALRNKATK-AHHCGASILDKT 748

  Fly    77 WVLTAAHCTSGASAVTIYYGATVRTSAQLVQTVSADN----------FVQHASYNSI---VLRND 128
            .::|||||          :....|.|:..|.....||          ::|...:..:   :..:|
 Worm   749 HLITAAHC----------FEEDERVSSYEVVVGDWDNNQTDGNEQIFYLQRIHFYPLYKDIFSHD 803

  Fly   129 ISLIKT--PTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVS 191
            |::::.  |.:.|......:.||:....|:  .|:|.:.||||   ......|..||..:..:::
 Worm   804 IAILEIPYPGIEFNEYAQPICLPSKDFVYT--PGRQCVVSGWG---SMGLRYAERLQAALIPIIN 863

  Fly   192 VSQCQNT---YGSLVATNNVICVA-TPNKVSTCNGDSGGPLVLVSDS---KLIGVTSFVSSAGC- 248
            ...|.|:   |.|:  :.:..|.. ....:.:|.||||||.....:.   .|.||.|:  ..|| 
 Worm   864 RFDCVNSSQIYSSM--SRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISW--GDGCA 924

  Fly   249 ESGAPAGFTRVTSYLDWI 266
            :...|..:|.|..||.||
 Worm   925 QKKQPGIYTMVAPYLSWI 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 63/249 (25%)
Tryp_SPc 40..269 CDD:238113 64/250 (26%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 64/250 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.