DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Tpsb2

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:291 Identity:86/291 - (29%)
Similarity:126/291 - (43%) Gaps:49/291 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVLVVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGS 65
            :|.|::...||:     ||...|...||  ||  |....|..|..|:..::|:||.|.|......
Mouse     2 LKRLLLLLWALS-----LLASLVYSAPR--PA--NQRVGIVGGHEASESKWPWQVSLRFKLNYWI 57

  Fly    66 WWCGGSIIDNTWVLTAAHCTSGASAVT------------IYYGATVRTSAQLVQTVSADNFVQHA 118
            .:||||:|...||||||||. |....:            :|||.         |.:|.:..|.|.
Mouse    58 HFCGGSLIHPQWVLTAAHCV-GPHIKSPQLFRVQLREQYLYYGD---------QLLSLNRIVVHP 112

  Fly   119 SYNSIVLRNDISLIKTPT-VAFTALINKVELPAIAGTYSTYTGQQAIASGWGK-TSDSATSVANT 181
            .|.:.....|::|::... |..:..::.:.||..:.|:.  .|.....:|||. .:|........
Mouse   113 HYYTAEGGADVALLELEVPVNVSTHLHPISLPPASETFP--PGTSCWVTGWGDIDNDEPLPPPYP 175

  Fly   182 LQYEVFEVVSVSQCQNTYGSLVAT--------NNVICVATPNKVSTCNGDSGGPLVL-VSDSKL- 236
            |:.....:|..|.|...|.:.:.|        :.::|.....: .:|.||||||||. |..:.| 
Mouse   176 LKQVKVPIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTRR-DSCQGDSGGPLVCKVKGTWLQ 239

  Fly   237 IGVTSFVSSAGC-ESGAPAGFTRVTSYLDWI 266
            .||.|:  ..|| :...|..:||||.|||||
Mouse   240 AGVVSW--GEGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 72/251 (29%)
Tryp_SPc 40..269 CDD:238113 74/252 (29%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 74/252 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.