DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG43742

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:280 Identity:79/280 - (28%)
Similarity:125/280 - (44%) Gaps:49/280 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLVVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSWW 67
            :|:|..:....|.|.||.:...:         .|..|:.||.||.:.||     ::....:..::
  Fly     7 LLLVAVVIYQNAFAQLLDENCKV---------KITYRVANGHTAITSQF-----MAALYNNSEFF 57

  Fly    68 CGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTS----AQLVQTVSADNFVQHASYNSIVLRND 128
            ||||:|...:|||||||......||::.|...|:.    .:.|..::| ..:.|.:::..:..||
  Fly    58 CGGSLIHKQYVLTAAHCVRDLDEVTVHLGENNRSCPIPVCKHVLRLNA-KVILHPNFHGNIFLND 121

  Fly   129 ISLIKTP-TVAFTALINKV----ELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFE 188
            |:|::.. .|.|.|.|..:    :....:...:.:|     |.|||||...  ::::.|.:....
  Fly   122 IALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFT-----AYGWGKTEHG--NISDVLSFIDLV 179

  Fly   189 VVSVSQC-QNTYGSLVATNNVICVATPNKVSTCNGDSGGPLV--LVSDSK----LIGVTSFVSSA 246
            .:..|.| ||.        |.||..:.:. .||..||||||:  .|...|    |.|:||: ..|
  Fly   180 RLPKSMCYQNI--------NTICAGSTSG-DTCESDSGGPLIGNFVHRGKSRDILFGITSY-GDA 234

  Fly   247 GCESGAPAGFTRVTSYLDWI 266
            .| ||....:|.|.:|..||
  Fly   235 EC-SGLFGVYTDVNAYKSWI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 70/242 (29%)
Tryp_SPc 40..269 CDD:238113 71/243 (29%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 70/242 (29%)
Tryp_SPc 35..256 CDD:238113 71/243 (29%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436243
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.