DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG43124

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:209 Identity:42/209 - (20%)
Similarity:80/209 - (38%) Gaps:45/209 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 CGGSIIDNTWVLTAAHCTSGASAVTIYYGA-TVRTSAQLVQTVSADNFVQHASYNSIVLRNDISL 131
            |.|::|:|.:|||||.|......:|:..|: ....|.:..:...|..::.|...|:   .|::.:
  Fly    54 CAGALINNLYVLTAASCFKENEKLTVRLGSGYFDKSYENFRVTKAYFWMTHFPANN---TNNLCI 115

  Fly   132 IKTPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQ-- 194
            .:..|        :||       :.|:.....|..     |..:..:|.|     ||:::...  
  Fly   116 FRLQT--------EVE-------FKTHIRPMCITK-----SPKSLGLATT-----FEIINEKPKM 155

  Fly   195 ---CQNTYGSLVATNNVIC--VATPNKVSTCNGDSGGPLV-LVSDSKLIGVTSF-VSSAGCESGA 252
               |:|..|       :.|  |...|:....:..:|.|.. .:|:....|:..: :.|.......
  Fly   156 WYFCKNIKG-------LFCKYVFGENEEKWQSKPTGSPWTETISNGPFKGLVRYGILSYRDNKTY 213

  Fly   253 PAGFTRVTSYLDWI 266
            ...:..|.|:::||
  Fly   214 DEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 40/207 (19%)
Tryp_SPc 40..269 CDD:238113 42/209 (20%)
CG43124NP_001247345.1 Tryp_SPc 41..>133 CDD:304450 21/96 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.