DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and LOC1277262

DIOPT Version :10

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_316708.5 Gene:LOC1277262 / 1277262 VectorBaseID:AGAMI1_011272 Length:329 Species:Anopheles gambiae


Alignment Length:45 Identity:10/45 - (22%)
Similarity:19/45 - (42%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AISPSQQEEINQHNPGIYHQKLLYKVQQWRTSLKESNSVELKLSL 60
            |..|..:...::..|.|..:::.|.....|..|.:.|..:..:||
Mosquito    39 AFPPKLEPRFDRPAPEIPVRQIFYAEDVVRAKLHKENKPQETISL 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 6/22 (27%)
LOC1277262XP_316708.5 None

Return to query results.
Submit another query.