DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and LOC1269949

DIOPT Version :10

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_308603.5 Gene:LOC1269949 / 1269949 VectorBaseID:AGAMI1_004627 Length:276 Species:Anopheles gambiae


Alignment Length:32 Identity:12/32 - (37%)
Similarity:14/32 - (43%) Gaps:7/32 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VILLLLLCVFAISPSQQEEINQ------HNPG 31
            :.||.|..|.|:.| |...|.|      .|||
Mosquito     8 IFLLFLYPVVAVVP-QGFTIKQPKCWYVANPG 38

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473
LOC1269949XP_308603.5 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.