DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and Ctrl

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:261 Identity:91/261 - (34%)
Similarity:138/261 - (52%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LPAVT---NIEGRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHC--TSGAS 89
            :||:|   :...||.||:.|..|.:|:||.|.  ..:|..:||||:|...||:|||||  |.|..
  Rat    21 VPAITPALSYNQRIVNGENAVPGSWPWQVSLQ--DNTGFHFCGGSLIAPNWVVTAAHCKVTPGRH 83

  Fly    90 AVTIYYGATVRTS-AQLVQTVSADNFVQHASYNSIVLRNDISLIKTPTVA-FTALINKV------ 146
            .|.:  |...|:| |:.:|.:|....:.|.|:|...:.||::|:|..:.| :||.::.|      
  Rat    84 FVIL--GEYDRSSNAEPIQVLSISKAITHPSWNPNTMNNDLTLLKLASPARYTAQVSPVCLASSN 146

  Fly   147 -ELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVIC 210
             .|||         |...:.:|||:.|.........||..|..:|:|:||:..:||.: |:::||
  Rat   147 EALPA---------GLTCVTTGWGRISGVGNVTPARLQQVVLPLVTVNQCRQYWGSRI-TDSMIC 201

  Fly   211 VATPNKVSTCNGDSGGPLVLVSDSK--LIGVTSFVSSAGCESGAPAGFTRVTSYLDWIKTNTGVS 273
            ..... .|:|.||||||||....:.  |||:.|: .:..|...|||.:|||:.:..||  |..::
  Rat   202 AGGAG-ASSCQGDSGGPLVCQKGNTWVLIGIVSW-GTENCNVQAPAMYTRVSKFNTWI--NQVIA 262

  Fly   274 Y 274
            |
  Rat   263 Y 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 84/239 (35%)
Tryp_SPc 40..269 CDD:238113 85/241 (35%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 84/239 (35%)
Tryp_SPc 34..260 CDD:238113 86/243 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.