DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and PRSS21

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:299 Identity:85/299 - (28%)
Similarity:123/299 - (41%) Gaps:50/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LALATASAGL-LPQQVPIHPRDLPAVTN-IEGRITNGKTATSGQFPYQVGLSFASTSGSWW---- 67
            |||..|.||| .|:.....|...|.... |..||..|:.|..|::|:|..|..       |    
Human     9 LALLLARAGLRKPESQEAAPLSGPCGRRVITSRIVGGEDAELGRWPWQGSLRL-------WDSHV 66

  Fly    68 CGGSIIDNTWVLTAAHC------TSGASAVTIYYG-ATVRTSAQLVQTVSADNFVQHASYNSIVL 125
            ||.|::.:.|.||||||      .|..|...:.:| .|...|...:|......||.:...:...|
Human    67 CGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYL 131

  Fly   126 RN---DISLIK-TPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGK-TSDSATSVANTLQYE 185
            .|   ||:|:| :..|.:|..|..:.|.  |.|:..........:|||. ..|.|....:|||..
Human   132 GNSPYDIALVKLSAPVTYTKHIQPICLQ--ASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEV 194

  Fly   186 VFEVVSVSQC----------QNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDS--KLIG 238
            ...:::.|.|          ::.:|.:|...|    |...| ..|.|||||||....:.  ..||
Human   195 QVAIINNSMCNHLFLKYSFRKDIFGDMVCAGN----AQGGK-DACFGDSGGPLACNKNGLWYQIG 254

  Fly   239 VTSFVSSAGC-ESGAPAGFTRVTSYLDWIK---TNTGVS 273
            |.|:  ..|| ....|..:|.::.:.:||:   ..:|:|
Human   255 VVSW--GVGCGRPNRPGVYTNISHHFEWIQKLMAQSGMS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 70/255 (27%)
Tryp_SPc 40..269 CDD:238113 71/260 (27%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 71/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.