DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and CG42694

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:251 Identity:59/251 - (23%)
Similarity:105/251 - (41%) Gaps:43/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GRITNGKTATSGQFPYQVGLSFASTSGSWWCGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRTS 102
            |...:.::.|..:.|....|:..|......|.||:|...:||:||.|......:.:..|.:..|.
  Fly    28 GAPISNQSITKLRQPQAGWLAHISNGTHVLCSGSLISKQFVLSAAQCIDVHGKLFVQLGVSNATK 92

  Fly   103 AQLVQTVSADNFVQHASYNSIVLRNDISLIK-TPTVAFTALI---------NKVELPAIAGTYST 157
            :....|||.   |...|::...|:.||.|:| :.:|.:...:         |.:::..|...::|
  Fly    93 SPHWYTVSN---VVIPSHSGKRLQRDIGLLKLSQSVDYNDFVYPICIALNTNTLDMVKILQNFTT 154

  Fly   158 YTGQQAIASGW-GKTSDSATSVANTLQYEVFEVVSVSQCQ-NTYGSLVATNNVICVATPNKVSTC 220
                    |.| .|..:..|.|.:.|        |..:|: |..|::  |...||.|:..:.::|
  Fly   155 --------SAWLSKNKNPQTIVLSQL--------SRDRCKLNLSGNV--TPKEICAASLQRNNSC 201

  Fly   221 NGDSGGPLV--LVSDSKLI-----GVTSFVSS-AGCESGAPAGFTRVTSYLDWIKT 268
            ..|||..|.  ::..|.::     |:..:|:. :.|..  ||.:..|...:.||:|
  Fly   202 FIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWCSE--PAIYIDVAECVGWIET 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 55/246 (22%)
Tryp_SPc 40..269 CDD:238113 58/249 (23%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 56/233 (24%)
Tryp_SPc 46..253 CDD:214473 53/229 (23%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.