DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiii and LOC100489516

DIOPT Version :9

Sequence 1:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster
Sequence 2:XP_002935402.2 Gene:LOC100489516 / 100489516 -ID:- Length:263 Species:Xenopus tropicalis


Alignment Length:269 Identity:99/269 - (36%)
Similarity:140/269 - (52%) Gaps:25/269 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVFALALATASAGLLPQQVPIHPRDLPAVTNIEGRITNGKTATSGQFPYQVGLSFASTSGSW-WC 68
            :|..|||||...|....|:      .|.||.. .||.||:.|..|.:|:||.|   ..|.|| :|
 Frog     6 LVSCLALATTVYGCGQPQI------APVVTGY-ARIVNGEEAVPGSWPWQVSL---QDSTSWHFC 60

  Fly    69 GGSIIDNTWVLTAAHCTSGASA-VTIYYGATVRTS-AQLVQTVSADNFVQHASYNSIVLRNDISL 131
            |||:|:|.||:|||||  |.|. ..:..|...|.| .:.:|:::......|..:||..:.|||||
 Frog    61 GGSLINNEWVVTAAHC--GVSTRDKVVLGEHDRNSNVEKIQSLAVAKVFTHPQWNSNTINNDISL 123

  Fly   132 IK--TPTVAFTALINKVELPAIAGTYSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQ 194
            ||  ||.| ..|.:..|.|..|...|.  .|:..:.||||||..:|.:..|.||.....:::..|
 Frog   124 IKLATPAV-LGATVAPVCLANIGEDYE--GGRICVTSGWGKTRYNAFTTPNLLQQTALPLLTNDQ 185

  Fly   195 CQNTYGSLVATNNVICVATPNKVSTCNGDSGGPLVLVSDS--KLIGVTSFVSSAGCESGAPAGFT 257
            |::.:|:.: |..:||...... |:|.||||||||..::.  .|:|:.|:.||. |.:.:|..:.
 Frog   186 CKSYWGNNI-TGTMICAGAAGS-SSCMGDSGGPLVCQANDAWTLVGIVSWGSSM-CATNSPGVYA 247

  Fly   258 RVTSYLDWI 266
            |||....|:
 Frog   248 RVTVLRSWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 87/233 (37%)
Tryp_SPc 40..269 CDD:238113 87/234 (37%)
LOC100489516XP_002935402.2 Tryp_SPc 33..256 CDD:214473 87/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.