DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and Ctrc

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001029047.1 Gene:Ctrc / 76701 MGIID:1923951 Length:268 Species:Mus musculus


Alignment Length:282 Identity:90/282 - (31%)
Similarity:134/282 - (47%) Gaps:44/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAW--- 66
            ::.|:...||:..:|..         ..::..|:.||.:|....:|:||.|..   .....|   
Mouse     6 VLAAILACASSCGDPTF---------PPNLSARVVGGEDAVPNSWPWQVSLQY---LRDDTWRHT 58

  Fly    67 CGGSLIGSTWVLTAAHCTDGVQSVTVYLG---ATVRTS-----AEITHTVSSSDIIIHSGWNSAN 123
            ||||||.::.|||||||.:...:..|.||   .||...     ||:      ..|.:|..||...
Mouse    59 CGGSLITTSHVLTAAHCINTNLTYRVGLGKYNLTVEDEEGSVYAEV------DTIYVHEKWNRLL 117

  Fly   124 LRNDISLIKI--PATSSSSRISAVKLPSISNSYSTFVGDV-AVASGWGRTSDTSSGVATNLQYVD 185
            |.|||::||:  |...|.:    :::..|....|...||. ...:||||.. |:..:|..||...
Mouse   118 LWNDIAIIKLAEPVELSDT----IQVACIPEQDSLLPGDYPCYVTGWGRLW-TNGPIAEVLQQGL 177

  Fly   186 LTVITNTKCAQ-TYGTSVVTDSTLCVATTDAKSTCNGDSGGPL--VLKSSSEQI-GLTSFGASAG 246
            ..::.:|.|:: .:....|.::.:|.......|.|||||||||  .::....|: |:.|||:|.|
Mouse   178 QPIVNHTTCSRLDWWFIKVRETMVCAGGDGVISACNGDSGGPLNCPVEDGLWQVHGIVSFGSSRG 242

  Fly   247 CEKGY--PAAFTRVTSYLDWIK 266
            |.. |  |..||||::|:||||
Mouse   243 CNT-YKKPVVFTRVSAYIDWIK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 83/247 (34%)
Tryp_SPc 38..268 CDD:238113 85/249 (34%)
CtrcNP_001029047.1 Tryp_SPc 29..262 CDD:214473 83/247 (34%)
Tryp_SPc 30..265 CDD:238113 85/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.