DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and Prss22

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:297 Identity:80/297 - (26%)
Similarity:130/297 - (43%) Gaps:56/297 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFLIILALAVAASAFPEPELRHRSREMPVVGDIG-----GRITGGSNAAVGQFPYQVGLSLKLSA 61
            :|.|::.|.:..|..|......|     |..|.|     .||.||.::...|:|:.|.: ||   
Mouse    72 QFSILILLVLLTSTAPISAATIR-----VSPDCGKPQQLNRIVGGEDSMDAQWPWIVSI-LK--- 127

  Fly    62 LSSAWCGGSLIGSTWVLTAAHC----TDGVQSVTVYLGA-TVRTSAEITHTVSSSDIIIHS--GW 119
            ..|..|.|||:.:.||:|||||    .|.....:|.||| .:.:....:..|..:.::.|.  .|
Mouse   128 NGSHHCAGSLLTNRWVVTAAHCFKSNMDKPSLFSVLLGAWKLGSPGPRSQKVGIAWVLPHPRYSW 192

  Fly   120 NSANLRNDISLIKIP-ATSSSSRI-------SAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSG 176
            .... ..||:|:::. :...|.||       |:|:||..::.:         .:|||...|   |
Mouse   193 KEGT-HADIALVRLEHSIQFSERILPICLPDSSVRLPPKTDCW---------IAGWGSIQD---G 244

  Fly   177 V----ATNLQYVDLTVITNTKCAQTY----GTSVVTDSTLCVATTDA-KSTCNGDSGGPLVLKSS 232
            |    ...||.:.:.:|.:..|...|    |...:|:..||....:. :..|.|||||||:.:..
Mouse   245 VPLPHPQTLQKLKVPIIDSELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVD 309

  Fly   233 SEQI--GLTSFGASAGC-EKGYPAAFTRVTSYLDWIK 266
            ...:  |:.|:|  .|| |:..|..:|.:.::..|::
Mouse   310 DHWLLTGIISWG--EGCAERNRPGVYTSLLAHRSWVQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 70/254 (28%)
Tryp_SPc 38..268 CDD:238113 70/256 (27%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 70/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.