DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and ctrb.2

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001038747.1 Gene:ctrb.2 / 692313 ZFINID:ZDB-GENE-060519-7 Length:263 Species:Danio rerio


Alignment Length:272 Identity:89/272 - (32%)
Similarity:132/272 - (48%) Gaps:23/272 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFL-IILALAVAASAF--PEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSAL 62
            |.|: |:|.||:..:|:  ..|.:      .||:... .||..|..|....:|:||.|.   .:.
Zfish     1 MAFVWILLCLALIGTAYGCGVPAI------PPVITGY-ARIVNGEEAVPHSWPWQVSLQ---DST 55

  Fly    63 SSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTS-AEITHTVSSSDIIIHSGWNSANLRN 126
            ...:||||||...||:|||||.... |..|.||...|:| ||...|::...:..|..:|...:.|
Zfish    56 GFHFCGGSLINEWWVVTAAHCNVRT-SHRVILGEHDRSSNAESIQTMTVGKVFKHPNFNMFTINN 119

  Fly   127 DISLIKIPATSS-SSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVIT 190
            ||.|||:...:. ::.:|.|.|...::::..  |...|.||||.|...:......||...|.::|
Zfish   120 DILLIKLATPAKINTHVSPVCLAETNDNFPG--GMKCVTSGWGLTKHNAPDTPALLQQAALPLLT 182

  Fly   191 NTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSS--EQIGLTSFGASAGCEKGYPA 253
            |..|.:.:|.. :||..:|...:.| |:|.||||||||.:...  ..:|:.|:|:|. |....|.
Zfish   183 NEDCKRFWGNK-ITDLMVCAGASGA-SSCMGDSGGPLVCQKDGVWTLVGIVSWGSSV-CSPSSPG 244

  Fly   254 AFTRVTSYLDWI 265
            .:.|||....|:
Zfish   245 VYARVTKLRAWV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 78/231 (34%)
Tryp_SPc 38..268 CDD:238113 78/232 (34%)
ctrb.2NP_001038747.1 Tryp_SPc 33..256 CDD:214473 78/231 (34%)
Tryp_SPc 34..259 CDD:238113 78/232 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.