DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG18754

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:283 Identity:73/283 - (25%)
Similarity:118/283 - (41%) Gaps:72/283 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PVVGDI------GGRIT------GGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAA 81
            |.:||:      .|:.|      |..||.:.::|:.| |.|..:.|       |||  .:|||||
  Fly    85 PELGDVLPNKQTCGQTTPVFRDRGAENAELNEYPWMV-LLLYENRL-------SLI--RYVLTAA 139

  Fly    82 HCTDG---VQSVTVYLGATVRTSAEITHTVSSS------DI-----IIHSGWNSA--NLRNDISL 130
            ||..|   .|:..|.  .:||.....|..::|.      |:     .:|.|:.|:  ..||||:|
  Fly   140 HCVIGGYLTQNDLVL--KSVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIAL 202

  Fly   131 IKIPATSSSSRISAVKLPSISNSYSTF-VGDVAV-ASGWGRTSDTSSGVATNLQYVDLTVITNT- 192
            :::......::    |:..|....:.| :.|:.: .|||..|..:.            |:||:| 
  Fly   203 LRLQFPVRYTK----KIQPICLLDAEFPLQDLNLQISGWDPTKSSQ------------TLITSTV 251

  Fly   193 ------KCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPL--VLKSSSEQI----GLTSFGASA 245
                  .|...| .|..:.|.:|........||.|.||.|:  ::.|..::.    |:.|:|...
  Fly   252 KERNPADCLNRY-PSFRSASQVCAGGQRKGDTCAGISGSPVMGIMGSGVDEFVFLAGIASYGQQY 315

  Fly   246 GCEKGYPAAFTRVTSYLDWIKTN 268
            ....|.|..:|::..:.:|||.|
  Fly   316 CYSAGIPGVYTKIGHFSEWIKAN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 65/264 (25%)
Tryp_SPc 38..268 CDD:238113 68/266 (26%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855
Tryp_SPc 108..338 CDD:238113 67/258 (26%)
Tryp_SPc 108..335 CDD:214473 64/255 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.