DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG34409

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:273 Identity:75/273 - (27%)
Similarity:126/273 - (46%) Gaps:56/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DIGGRITGGSNAAVGQFPY--QVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLG 95
            ::..|:.||..|:.||||:  ::....:.|:..|..|.||||.|..::|||||...:.|      
  Fly   245 NVESRLLGGDQASAGQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVS------ 303

  Fly    96 ATVRTSAEITHT-VSSSD---------IIIHSGWNSANLRNDISLIKIPATSSSSRISAVKLP-- 148
                 ..|::|. :.|.|         :|:|..::.....|||:|::|.:|:.:  .:.:.||  
  Fly   304 -----DLELSHVRLGSQDGATPFAIEQVIVHPNYDQPKYANDIALLRINSTNGT--FTPICLPFN 361

  Fly   149 ---SISNSYSTFVGDVAVASGW--GRTSDTSSGVATN----LQYVDLTVITNTKCAQTYGT---- 200
               ::.|   ..:|.:.||:||  |.|.:.||...:|    ::::.|.::..|.||..|.:    
  Fly   362 GPITLGN---RLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSEN 423

  Fly   201 ----SVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSS---------EQIGLTSFGASAGCEKGYP 252
                .|:|.:.||.........|.||||||.:...:|         ..||:.:||.:.......|
  Fly   424 FQQPIVITPNHLCAQGMPMNDVCRGDSGGPFMDDGTSGVFGTSGRYTIIGIVAFGPTLCGVTTIP 488

  Fly   253 AAFTRVTSYLDWI 265
            ..:|.|:|:.|||
  Fly   489 GVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 73/267 (27%)
Tryp_SPc 38..268 CDD:238113 74/268 (28%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 73/267 (27%)
Tryp_SPc 252..501 CDD:238113 72/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436258
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.940

Return to query results.
Submit another query.