DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and CG34171

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:219 Identity:57/219 - (26%)
Similarity:92/219 - (42%) Gaps:33/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 WCGGSLIGSTWVLTAAHC-TD--GV----QSVTVYLGATV-RTSAEITHTVSSSDIIIHSGWNSA 122
            :|.|.::.:..|||:||| ||  ||    :.:.|.|.|:: :|.......|...::|||..:: .
  Fly    56 FCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVALCASLFKTPESEEFVVDIHNMIIHPYYH-R 119

  Fly   123 NLRNDISLIKIPATSSSSRISAVKL------PSISNSYSTFVG-DVAVASGWGRTSDTSSGVATN 180
            |..|||::||:.        ..|||      |.:..:.|..|| |.....|.........|...:
  Fly   120 NQHNDIAIIKLK--------RYVKLDGHHLAPVVLGNSSLEVGNDCKTIGGIFGVRRQRFGSFHS 176

  Fly   181 LQYVDLTVITNTKCAQTYGTSVV----TDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQIGLTSF 241
            :..|::.:....:|.:...:.:.    .:..:||.:|: |..|..|.||||........|.|   
  Fly   177 MLLVNVELRPFDECLKVKKSLMAARPENEDLICVKSTE-KQMCTTDFGGPLFCDGQLYGIAL--- 237

  Fly   242 GASAGCEKGYPAAFTRVTSYLDWI 265
             .|..|....|..|:.|:.|..|:
  Fly   238 -GSINCSSPDPVFFSDVSFYNSWV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 56/217 (26%)
Tryp_SPc 38..268 CDD:238113 57/219 (26%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 56/217 (26%)
Tryp_SPc 38..263 CDD:304450 57/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471227
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.