DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:257 Identity:87/257 - (33%)
Similarity:121/257 - (47%) Gaps:35/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHC--TDGVQSVTVYLG---A 96
            ||.||.||..|.:|:.|.|..:.    ..:||||||.:.||||||||  .....|:.||||   :
Zfish    35 RIVGGVNATHGAWPWMVSLQGRY----GHFCGGSLINNQWVLTAAHCIVDQTPSSIIVYLGKWRS 95

  Fly    97 TVRTSAEITHTVSSSDIIIHSGWNSANLRNDISLIKIPATSSSSRISAVK----------LPSIS 151
            .|.....|:.|:  ..||.|..:::....|||:|:::  ||:......:|          .|..:
Zfish    96 YVADVNSISRTI--RHIIPHPSYSNITKDNDIALLQL--TSTVQYTDYIKPICLADENSNFPRGT 156

  Fly   152 NSYSTFVGDVAVASGWGRTSDTSSGVATN----LQYVDLTVITNTKCAQ-TYGTSVVTDSTLCVA 211
            ||:....||:.|....|....|:..|...    ||..:|.|.:|..|.. .:|.  :|.:.:|..
Zfish   157 NSWVAGWGDIGVLGTGGIRGRTTVSVPLPHPGILQEAELKVYSNADCNNICHGR--ITPNMICAG 219

  Fly   212 T-TDAKSTCNGDSGGPLVLKSSS-EQIGLTSFGASAGC-EKGYPAAFTRVTSYLDWIKTNTG 270
            | ...|:|.:|||||||:.|.|. .|.|:.|.|  .|| :...|..|.||:.|..||..|.|
Zfish   220 TRPGGKATFSGDSGGPLMTKCSVWVQAGVLSHG--YGCAQPNLPEVFIRVSEYKQWITGNVG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 83/250 (33%)
Tryp_SPc 38..268 CDD:238113 84/252 (33%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 82/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.