DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and ela3l

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_021331840.1 Gene:ela3l / 554107 ZFINID:ZDB-GENE-060710-2 Length:270 Species:Danio rerio


Alignment Length:277 Identity:92/277 - (33%)
Similarity:139/277 - (50%) Gaps:30/277 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FLIILALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWC 67
            |.:|||..:.||||        ....|.:..:..|:..|..|....:|:||.|..:..:.....|
Zfish     2 FALILASVLIASAF--------GCGKPPIEPLMSRVVNGEEARPHSWPWQVSLQYQSGSSFYHTC 58

  Fly    68 GGSLIGSTWVLTAAHCTDGVQSVTVYLGA-TVRTSAEITHTVSSSDIIIHSGWNS--ANLRNDIS 129
            |||:|...||:|||||....::..|.:|. .:..:.|.:.|:|:..||:|..|||  ..|.|||:
Zfish    59 GGSIIAENWVMTAAHCISSGRNYRVLVGKHDLSVNEEGSQTISAQKIIVHEKWNSMFVALGNDIA 123

  Fly   130 LIKI--PAT-SSSSRISAVKLPS--ISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVI 189
            |||:  |.| |.:.::..|..|.  :.|:|..::      |||||.| |...:...||...:..:
Zfish   124 LIKLAEPVTLSDTIQLGCVPAPGDVLPNNYPCYI------SGWGRLS-TGGALPDRLQQALMPAV 181

  Fly   190 TNTKCAQ--TYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSS---EQIGLTSFGASAGCEK 249
            .:..|::  .:|:| |.::.:|.......:.|||||||||..|:|.   |..|:.||.:..||..
Zfish   182 DHATCSRFDWWGSS-VKETMVCAGGDGVVAGCNGDSGGPLNCKNSDGIWEVHGIASFVSGLGCNT 245

  Fly   250 -GYPAAFTRVTSYLDWI 265
             ..|..||||:|:.||:
Zfish   246 IRKPTVFTRVSSFTDWV 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 82/241 (34%)
Tryp_SPc 38..268 CDD:238113 82/242 (34%)
ela3lXP_021331840.1 Tryp_SPc 29..265 CDD:238113 82/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.