DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and ctrb.3

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001017724.1 Gene:ctrb.3 / 550419 ZFINID:ZDB-GENE-050417-229 Length:265 Species:Danio rerio


Alignment Length:291 Identity:90/291 - (30%)
Similarity:132/291 - (45%) Gaps:59/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIIL--------ALAVAASAFPEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSL 57
            |.||.:|        |......|.|           |||... .||..|..|....:|:||.|. 
Zfish     1 MAFLWLLSCVAFFSAAYGCGVPAIP-----------PVVSGY-ARIVNGEEAVPHSWPWQVSLQ- 52

  Fly    58 KLSALSSAWCGGSLIGSTWVLTAAHCTDGVQSVTVYLGATVRTS---------------AEITHT 107
              ......:||||||...||:|||||             :||||               .|...|
Zfish    53 --DFTGFHFCGGSLINEFWVVTAAHC-------------SVRTSHRVILGEHNKGKSNTQEDIQT 102

  Fly   108 VSSSDIIIHSGWNSANLRNDISLIKIPATSS-SSRISAVKLPSISNSYSTFVGDVAVASGWGRTS 171
            :..|.:..|..:||..:.|||:|:|:.|.:| ::.:|.|.|...|:::::  |...|.||||.|.
Zfish   103 MKVSKVFTHPQYNSNTIENDIALVKLTAPASLNAHVSPVCLAEASDNFAS--GMTCVTSGWGVTR 165

  Fly   172 DTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSS--E 234
            ..:......||.|.|.:::|..|...:|:: :.|:.:|.....| |:|.||||||||.:..:  .
Zfish   166 YNALFTPDELQQVALPLLSNEDCKNHWGSN-IRDTMICAGAAGA-SSCMGDSGGPLVCQKDNIWT 228

  Fly   235 QIGLTSFGASAGCEKGYPAAFTRVTSYLDWI 265
            .:|:.|:|:|. |:...|..:.|||...||:
Zfish   229 LVGIVSWGSSR-CDPTMPGVYGRVTELRDWV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 79/245 (32%)
Tryp_SPc 38..268 CDD:238113 79/246 (32%)
ctrb.3NP_001017724.1 Tryp_SPc 33..258 CDD:214473 79/245 (32%)
Tryp_SPc 34..261 CDD:238113 79/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.