DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and ctrl

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001015686.1 Gene:ctrl / 548358 XenbaseID:XB-GENE-5876074 Length:263 Species:Xenopus tropicalis


Alignment Length:273 Identity:91/273 - (33%)
Similarity:145/273 - (53%) Gaps:25/273 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLIILA-LAVAASAF--PEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSAL 62
            |.||.:|: :|:..|.:  ..|.:      .||:... .||..|.||..|.:|:||.|.   .:.
 Frog     1 MAFLWLLSCIALIGSTYGCGSPAI------SPVLSGY-ARIVNGENAVPGSWPWQVSLQ---DST 55

  Fly    63 SSAWCGGSLIGSTWVLTAAHCTDGVQSV-TVYLGATVRTS-AEITHTVSSSDIIIHSGWNSANLR 125
            ...:||||:|...||:|||||  ||.:. .|.||...|:| ||...|.:.:.:..|..:||..:.
 Frog    56 GFHFCGGSVISDFWVVTAAHC--GVTTAHRVILGEYDRSSPAEPIQTKTIAKVFRHPNYNSFTIA 118

  Fly   126 NDISLIKIPATSSSSRISA-VKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVI 189
            |||:|:|:.:.:|.|.|.| |.:.|.|::::.  |:..|.:|||.....|......||.|.|.::
 Frog   119 NDITLLKLSSPASFSNIVAPVCVASSSDAFNG--GERCVTTGWGYVDAASRLTPNKLQQVALPLL 181

  Fly   190 TNTKCAQTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSEQI--GLTSFGASAGCEKGYP 252
            :||:|.:.:|:.::  :|:..|.....|:|.||||||||.:.:...:  |:.|:|:|. |....|
 Frog   182 SNTECQRYWGSKIL--NTMVCAGASGASSCMGDSGGPLVCQRNGAWVLAGIVSWGSST-CSPSSP 243

  Fly   253 AAFTRVTSYLDWI 265
            ..:.||::...|:
 Frog   244 GVYARVSTLRSWM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 81/232 (35%)
Tryp_SPc 38..268 CDD:238113 81/233 (35%)
ctrlNP_001015686.1 Tryp_SPc 34..259 CDD:238113 81/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.