DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and ctrb2

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001011477.1 Gene:ctrb2 / 496968 XenbaseID:XB-GENE-1002990 Length:263 Species:Xenopus tropicalis


Alignment Length:242 Identity:84/242 - (34%)
Similarity:132/242 - (54%) Gaps:16/242 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWCGGSLIGSTWVLTAAHCTDGV-QSVTV 92
            |::... .||..|.||..|.:|:||.|.   ......:|||||:.:.||:|||||  || .|..|
 Frog    26 PIISGY-ARIVNGENAVSGSWPWQVSLQ---DRTGFHFCGGSLVNNLWVVTAAHC--GVTTSHRV 84

  Fly    93 YLGATVR-TSAEITHTVSSSDIIIHSGWNSANLRNDISLIKIPATSS-SSRISAVKLPSISNSYS 155
            .||...| :|||...|:|.|.:..|..:|:..:.|||:|:|:.:|:| :||::.|.:|:.|..::
 Frog    85 ILGEYDRSSSAEPIQTMSISRVFKHPNYNTNTMINDITLLKLSSTASFNSRVAPVCIPTSSEVFN 149

  Fly   156 TFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTLCVATTDAKSTCN 220
            :  .:..:.:|||.....|......||.|.|.:::||:|.:.:|..:  .||:..|.....|:|.
 Frog   150 S--PERCITTGWGYVDAYSKLSPNKLQQVTLPLLSNTECQRYWGNKI--HSTMICAGASGASSCM 210

  Fly   221 GDSGGPLVLKSSSEQI--GLTSFGASAGCEKGYPAAFTRVTSYLDWI 265
            ||||||||...:...:  |:.|:|:|. |....|..:.||::...|:
 Frog   211 GDSGGPLVCARNGAWVLAGIVSWGSST-CSPSSPGVYARVSTLRSWM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 82/232 (35%)
Tryp_SPc 38..268 CDD:238113 82/233 (35%)
ctrb2NP_001011477.1 Tryp_SPc 34..259 CDD:238113 82/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.