DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon65Aiv and ctrl

DIOPT Version :9

Sequence 1:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:267 Identity:100/267 - (37%)
Similarity:138/267 - (51%) Gaps:22/267 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IILALAVAASAF--PEPELRHRSREMPVVGDIGGRITGGSNAAVGQFPYQVGLSLKLSALSSAWC 67
            ||...|:.||..  ..|.::      ||:... .||..|.||..|.:|:||.|.   .:....:|
Zfish     4 IISCFALVASTLGCGVPAIK------PVISGY-NRIVNGENAVSGSWPWQVSLQ---QSNGFHFC 58

  Fly    68 GGSLIGSTWVLTAAHCTDGVQSVTVYLGATVR-TSAEITHTVSSSDIIIHSGWNSANLRNDISLI 131
            |||||...||:|||||........|.||...| :|||.....|.:..|.|..:||.|..|||:|:
Zfish    59 GGSLINQYWVVTAAHCRVQAGYHYVILGEHDRGSSAESVQVKSIAKAITHPYYNSQNFNNDITLL 123

  Fly   132 KIPATSS-SSRISAVKLPSISNSYSTFVGDVAVASGWGRTSDTSSGVATNLQYVDLTVITNTKCA 195
            |:.:.:. :||||.|.|.:.|.|..:  |...|.:|||:|..|||  ...||...|.:::..:|.
Zfish   124 KLSSPAQLTSRISPVCLAASSTSIPS--GTRCVTTGWGKTGSTSS--PRILQQTALPLLSPAQCK 184

  Fly   196 QTYGTSVVTDSTLCVATTDAKSTCNGDSGGPLVLKSSSE--QIGLTSFGASAGCEKGYPAAFTRV 258
            |.:|.:.:||:.:| |.....|:|.||||||||.:||..  |:|:.|:|.| .|....||.:.||
Zfish   185 QYWGQNRITDAMIC-AGASGVSSCQGDSGGPLVCESSGAWYQVGIVSWGTS-DCNVRTPAVYARV 247

  Fly   259 TSYLDWI 265
            :....||
Zfish   248 SYLRQWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 90/231 (39%)
Tryp_SPc 38..268 CDD:238113 91/232 (39%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 90/231 (39%)
Tryp_SPc 32..257 CDD:238113 91/232 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.